★★★★★
★★★★★
Verified Buyer
It was my first time ordering from this company and the process was quick and easy.
Uso del producto: Este producto está destinado exclusivamente a la investigación.
Toda la información de los productos de este sitio web tiene fines exclusivamente educativos. Cualquier forma de introducción en el cuerpo de personas o animales está estrictamente prohibida por la ley. Este producto solo debe ser manipulado por profesionales autorizados y cualificados. No es un medicamento, alimento ni cosmético y no debe etiquetarse, utilizarse ni presentarse como tal.
Pureza del 99% garantizada
Solo para investigación
Pago seguro
GLP-2 (Teduglutide / GLP-2 Analogue 5mg Lyophilized Vial)
GLP-2 (Glucagon-Like Peptide-2) 5mg lyophilized peptide standard for intestinal mucosal, crypt cell, and gastrointestinal barrier research.
La misma fórmula de confianza. Nuevo diseño.
Durante el cambio de envase, puedes recibir productos con la etiqueta anterior o con la nueva. La formulación, la pureza y la calidad siguen siendo exactamente las mismas, según nuestros estándares.
Métodos de pago aceptados
- Tarjeta de crédito
- Transferencia bancaria (SEPA inmediata)
- Transferencia bancaria (ACH)
- Wise
- Revolut
- Zelle
- Remitly
- Western Union
- Chime
- Otros
-25% en todo – hasta el 31 de octubre
25% sobre los precios habituales, en sustitución de otras ofertas. Acumulable solo con el descuento crypto.
Envío
Envío en el día para pedidos en EE. UU. realizados antes de las 12:00 EST.
Ver la política de envíos →Devoluciones
Devoluciones sin complicaciones en 30 días para productos sin abrir.
Ver la política de devoluciones →Analizado en laboratorio
Cada lote se analiza para comprobar su pureza, potencia y calidad.
Ver resultados de laboratorio →Resumen
Peptide Monograph: GLP-2 (33 Amino Acids)
Glucagon-Like Peptide-2 (GLP-2) is a 33-amino-acid peptide co-secreted with GLP-1 from intestinal L-cells. It selectively activates the GLP-2 receptor in enteric neurons and subepithelial myofibroblasts, promoting mucosal growth, crypt cell proliferation, and mesenteric blood flow.
Propiedades
- Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD
- Molecular Weight: 3752.1 g/mol
- Purity: ≥98.0% HPLC
- Format: 5mg Lyophilized Cake in 3ml sterile vial
- Reconstitution: Reconstitute with 1.0ml sterile bacteriostatic water.
- Storage: Store at -20°C. Protect from moisture and light.
Customer Reviews (8)
★★★★★
★★★★★
5 / 5
★★★★★
★★★★★
Verified Buyer
The quality is excellent, and the delivery was prompt.
★★★★★
★★★★★
Verified Buyer
Surpasses all competitors—best product ever.
★★★★★
★★★★★
Verified Buyer
Finally a place to trust. Definitely a bi-weekly customer here.
★★★★★
★★★★★
Verified Buyer
Fast shipping , great value. My current source and a good one. Reliable shipping, I never have to track rest assured it will show up in my mailbox in 2 to 3 days.
★★★★★
★★★★★
Verified Buyer
Exceptional service on the super fast shipping, quality is stellar. I will definitely be back. Results from my tests exceeded all expectations.
★★★★★
★★★★★
Verified Buyer
Highly satisfied with the fast turnaround times, it's an exceptionally pure batch. My laboratory research results exceeded expectations. Excellent all-round service.
★★★★★
★★★★★
Verified Buyer
Top-notch quality from the support team and the quality is absolutely top-tier. Our research results are completely exceeding expectations. Thanks for the outstanding support!
